PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29848.m004559
Common NameRCOM_0922020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family ARR-B
Protein Properties Length: 663aa    MW: 72791.9 Da    PI: 6.6306
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29848.m004559genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.72.6e-28196249155
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    kpr++W+ eLH++Fv av+qL G +kA+Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  29848.m004559 196 KPRVVWSVELHRKFVAAVNQL-GVDKAVPKKILDLMNVEKLTRENVASHLQKYRL 249
                    79*******************.********************************8 PP

2Response_reg77.35.5e-26201281109
                    EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTE CS
   Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGa 94 
                    vl vdD+p+ + +l+++l++ +y +v++++++ +al++l+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++a+++++++ + +  Ga
  29848.m004559  20 VLAVDDDPTCLLVLETFLRRCQY-HVTTTSQAISALKMLRENKnkFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSAYSDPKLVMKGITHGA 113
                    799********************.***************888888*******************87754.558*********************** PP

                    SEEEESS--HHHHHH CS
   Response_reg  95 kdflsKpfdpeelvk 109
                     d+l Kp+ +eel +
  29848.m004559 114 CDYLLKPVRIEELKN 128
                    ************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363925.3E-1621663IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23001.6E-4217168No hitNo description
SuperFamilySSF521721.57E-3617142IPR011006CheY-like superfamily
SMARTSM004483.2E-3218130IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.15219134IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.7E-2320128IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.51E-2721134No hitNo description
SuperFamilySSF466896.99E-20193253IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-30193254IPR009057Homeodomain-like
PROSITE profilePS5129412.505193252IPR017930Myb domain
TIGRFAMsTIGR015577.5E-25196249IPR006447Myb domain, plants
PfamPF002493.0E-7198248IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0016310Biological Processphosphorylation
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0016301Molecular Functionkinase activity
Sequence ? help Back to Top
Protein Sequence    Length: 663 aa     Download sequence    Send to blast
MTVEQGAGEA KDQFPIGMRV LAVDDDPTCL LVLETFLRRC QYHVTTTSQA ISALKMLREN  60
KNKFDLVISD VHMPDMDGFK LLELVGLEMD LPVIMLSAYS DPKLVMKGIT HGACDYLLKP  120
VRIEELKNIW QHVIRRKKVD NKDQNNFDNQ DKLPRGSGEA TADQKLNKKR KDQNEDEDED  180
RDEHGHENED PTTQKKPRVV WSVELHRKFV AAVNQLGVDK AVPKKILDLM NVEKLTRENV  240
ASHLQKYRLY LKRISTVANQ QANMVAALGS SDASYLQMGS GLGFQGIAGA GQFHNATFRP  300
LPPSGMLGRL NSPAGLGMRG LPSPGVIQLG QLQGTGHSSN NQSHFQMAVH PGNAGNVLQG  360
MPTSLELDQI QSNKGVTYIR ELPTDINDAT AFSVSGGFSD TKIMVGSSNS SFLGASNKPL  420
MLEGNTQGAQ DGKEFGKHSS LTVASLDSGF SSHLPDPGRC NDNWSSAVQS NGVQSTSFAL  480
NDCFRQTTLH PNNSRDSMST MGLQNGNNAP DISSISTLPI HLQESKADLQ CQITSIRSNA  540
GQIINNAPQG WDDQRQDSMY HSNAVHSSVN TANPIPGTGT LMGHSLDPKN TIFHRTTSFN  600
STRQTNFIDM PLMKHNDVEN LSMEILMRSN EGYVMAQQKL QSSYVSDNFG SLEDLANVMV  660
KQV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-26192255164ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015572552.10.0PREDICTED: two-component response regulator ARR12
SwissprotA2X1N21e-142ORR24_ORYSI; Two-component response regulator ORR24
TrEMBLB9RNX80.0B9RNX8_RICCO; Two-component system sensor histidine kinase/response regulator, putative
STRINGPOPTR_0006s27800.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-136response regulator 12